PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.18617s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 396aa    MW: 44546.7 Da    PI: 5.0882
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.18617s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-32198252155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+r+rWtpeLHe+Fvea++qL Gse+AtPk++l+lm+ +gLt++hvkSHLQkYR+
  Araha.18617s0002.1.p 198 KQRMRWTPELHEAFVEAINQLSGSERATPKAVLKLMNSPGLTIYHVKSHLQKYRT 252
                           79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.58E-17196252IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-30197254IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-22198252IPR006447Myb domain, plants
PfamPF002493.4E-9200251IPR001005SANT/Myb domain
PfamPF143791.4E-20286332IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MNNSPVPCQV FPLVSGGSSG GNLFSSSSGF CNGVYVSSSS QARPSVSTVQ RDRMTVAHVS  60
GEGQRQECSV ETQSLHLINQ PQEQKNMTWS SDQLQGFFDF PVPDPQAESS RTMVSSKEVL  120
LKYEWPDWAD QLISDDGLEP NWSELLGDPN VLNLDSKITP PSSDKARQEI VFENQHQVDP  180
SMEPFNTKNS PAISMTSKQR MRWTPELHEA FVEAINQLSG SERATPKAVL KLMNSPGLTI  240
YHVKSHLQKY RTARYKPELS ENTEEPQVKN LKTIEDIKSL DLKTSIEITE ALRLQMKVQK  300
QLHEQLEIQR SMQLQIEEQG RYLQMMIEKQ QQMQENKRDS EDDPSAPSPN PSQAFLPKAT  360
NSEPSITQKL QNGYSIMDQS ESASGTSNRK RVRED*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186300.0AK118630.1 Arabidopsis thaliana At3g04450 mRNA for putative transfactor, complete cds, clone: RAFL19-89-P11.
GenBankBT0053520.0BT005352.1 Arabidopsis thaliana At3g04445 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882350.10.0transcription factor
SwissprotQ8GUN51e-131PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLD7L2520.0D7L252_ARALL; Transcription factor
STRINGfgenesh1_pm.C_scaffold_30003240.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04450.20.0G2-like family protein